PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462884366
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 186aa    MW: 20803.6 Da    PI: 11.1247
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462884366genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.5e-192571148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd++l++ v+++G + W+ +ar ++ gR +kqc++rw ++l
        462884366 25 RGPWTSEEDDILKNMVREHGERKWAVVARALP-GRIGKQCRERWTNHL 71
                     89******************************.************996 PP

2Myb_DNA-binding57.72.7e-1878119245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        WT+e+d++l++a+k +G++ W+ Ia+ ++ gR+++ +k++w+
        462884366  78 SHWTEEDDKRLIEAHKTYGNR-WSVIAKFIP-GRSENAVKNHWN 119
                      67*******************.*********.***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.9282075IPR017930Myb domain
SuperFamilySSF466891.04E-3123118IPR009057Homeodomain-like
SMARTSM007171.2E-172473IPR001005SANT/Myb domain
PfamPF002495.1E-172571IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-262678IPR009057Homeodomain-like
CDDcd001674.73E-152771No hitNo description
SMARTSM007173.6E-1676124IPR001005SANT/Myb domain
PROSITE profilePS5129419.57476126IPR017930Myb domain
PfamPF002499.7E-1778119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-2279121IPR009057Homeodomain-like
CDDcd001677.79E-1480119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MAAGQPRAAG GGNVERAAPP PPPHRGPWTS EEDDILKNMV REHGERKWAV VARALPGRIG  60
KQCRERWTNH LRPDIKKSHW TEEDDKRLIE AHKTYGNRWS VIAKFIPGRS ENAVKNHWNA  120
TRRSLRAKRR LKKKKNAPAS PPGQQLSDLE EYIRALYPGD AAGANYSRAA GFSAVIVQPA  180
ARPGWG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-41211213103B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006645039.24e-64PREDICTED: protein rough sheath 2-like
SwissprotQ9S7L22e-45MYB98_ARATH; Transcription factor MYB98
TrEMBLK3XS586e-61K3XS58_SETIT; Uncharacterized protein
STRINGSi004755m2e-60(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.14e-44myb domain protein 119